PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR10G12670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 392aa    MW: 42144.9 Da    PI: 6.8044
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR10G12670.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.91.2e-09240297562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ + ++
  LPERR10G12670.1 240 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGMATQ 297
                      999******************************************9999887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-16236300IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565238301IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-8240295No hitNo description
PfamPF001703.6E-9240298IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.34E-10240290No hitNo description
CDDcd147034.33E-22241290No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MNNANELMMH RHLQQQQQGS GKQRAGLPPT PPPAAATSHG DVCMDGGGGL PPRKAHRRSR  60
SDVPFGYFQP LPPPSPKTET GWGGLLPGVG VGVSAGDDLL NAYMSMEGIS ATDGMNNNSD  120
GDSSGIRTNG GADSSENESE DYAGGGGDSQ VLLWGGGGGG EAAGKKRRSN VAGEPTAAAA  180
ARHARSLSMD SLMGKLSFAA NGDQPAKFSL EFGSGEFTPA EMKRIMADEK LAEMALADPK  240
RVKRVLANRQ SAARSKERRM RYIAELEQKV QILQTEATTL SAQLTLLQRD SSGMATQNNE  300
LKFRLQSMEQ QAQLRDALNE ALTAEVHRLK LAANEVGDTS SSSNLAHQIQ LRCQNQMLDL  360
HKQQQQQQAE QIPFYQLEQP EQNGTARNHE SK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613793.10.0PREDICTED: transcription factor RF2a-like
TrEMBLA0A0D9XLT50.0A0A0D9XLT5_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g38820.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-62bZIP family protein